PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013893719.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 112aa    MW: 12813.7 Da    PI: 9.7571
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013893719.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-18954247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       W++eEd +l+d+v ++G+ +W++Ia +mg gR  k+c++rw++ 
   XP_013893719.1  9 ATWSPEEDARLLDLVGRYGPQNWTAIAGHMGGGRNSKSCRLRWFNQ 54
                     58*****************************************996 PP

2Myb_DNA-binding52.31.3e-1661102144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      + ++T+eE + +++ ++q+G++ W++Ia++++ gRt++ +k++w
   XP_013893719.1  61 KEPFTEEEKQVIIEMHAQMGNK-WALIAKHLP-GRTDNAIKNYW 102
                      679*******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.29159IPR017930Myb domain
SuperFamilySSF466892.01E-317102IPR009057Homeodomain-like
SMARTSM007172.6E-14757IPR001005SANT/Myb domain
PfamPF002499.4E-17954IPR001005SANT/Myb domain
CDDcd001671.19E-111053No hitNo description
Gene3DG3DSA:1.10.10.601.4E-241062IPR009057Homeodomain-like
PROSITE profilePS5129416.04860109IPR017930Myb domain
SMARTSM007175.8E-1360108IPR001005SANT/Myb domain
PfamPF002497.5E-1561103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2363103IPR009057Homeodomain-like
CDDcd001671.22E-1163102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MGFTVVKRAT WSPEEDARLL DLVGRYGPQN WTAIAGHMGG GRNSKSCRLR WFNQLDPRVN  60
KEPFTEEEKQ VIIEMHAQMG NKWALIAKHL PGRTDNAIKN YWCARDALCG RT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-328102497MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-328102497C-Myb DNA-Binding Domain
1msf_C2e-328102497C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013893719.14e-81Transcription factor GAMYB
SwissprotA2WW873e-34GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC23e-34GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A0D2LSW64e-81A0A0D2LSW6_9CHLO; Transcription factor GAMYB
STRINGSb05g009460.15e-38(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.13e-39myb domain protein 56
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]